PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00069226001
Common NameGSBRNA2T00069226001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 309aa    MW: 34183.8 Da    PI: 8.3848
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00069226001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573119.41.9e-37100192298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                           fqrlwseeDe++lLqG+idfka+tgksp++d+d+fye+ +ksisf++sk q+v+Kir+LK+K+ +kvk+   g e s++k+hd ++++l
  GSBRNA2T00069226001 100 SFQRLWSEEDEVSLLQGMIDFKADTGKSPYEDMDRFYEITSKSISFEASKIQFVDKIRSLKRKYMGKVKH---GAE-SLTKNHDIDCLKL 185
                          69*****************************************************************999...555.9************ PP

               DUF573  92 skkiWgs 98 
                          ++ iWgs
  GSBRNA2T00069226001 186 ANYIWGS 192
                          *****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.4E-28101191IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MTKKKPNPLE DPPKASSSDD NEVEALSGDD EEEQISNDSS SDDLMNPVAI PSAKNSKSEK  60
PNAVTKPKGG SLAVKKRPIE TTSVSAKRAK IAEEAKKPSS FQRLWSEEDE VSLLQGMIDF  120
KADTGKSPYE DMDRFYEITS KSISFEASKI QFVDKIRSLK RKYMGKVKHG AESLTKNHDI  180
DCLKLANYIW GSHGMALNSN VKKLGKEEEV VALESAAKSS GTPKKSKKKP VSVEANASDW  240
FEDSFLVGSI AGLGVSERFV KEKWSMVTVE TKKRMEEKWK LLQAKEMELV LHKTDFMREI  300
GSVIAEAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229PKKSKKKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.58540.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723127.11e-170PREDICTED: mediator-associated protein 1-like
TrEMBLA0A078JRM10.0A0A078JRM1_BRANA; BnaCnng57540D protein
STRINGBra032717.1-P1e-165(Brassica rapa)
STRINGBra034488.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-67DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]